PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P03630_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 211aa    MW: 23813.1 Da    PI: 9.187
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P03630_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.41.8e-28959151
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           krien + rqvtfskRrng+lKKA ELSvLCdae+ +iifs +gklye++s
  GSMUA_Achr1P03630_001  9 KRIENATSRQVTFSKRRNGLLKKALELSVLCDAEIGLIIFSARGKLYEFAS 59
                           79***********************************************86 PP

2K-box52.81.7e-1879168899
                  K-box   8 s.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                            s + e++++ ++qe+a L  +ie L+ ++R++lGe+Les s++eL +Le +Le+sl+kiR kK +   e++ +lq+ke+ l een+ L
  GSMUA_Achr1P03630_001  79 SsAIEHENQPSRQEAASLFTKIEHLEASKRKILGENLESSSIEELGELEIKLEQSLRKIRGKKAK---EELVQLQQKENTLAEENTLL 163
                            2366778899*****************************************************86...99****************** PP

                  K-box  95 rkkle 99 
                            r+kl+
  GSMUA_Achr1P03630_001 164 REKLQ 168
                            **987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.4E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.314161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.63E-32385IPR002100Transcription factor, MADS-box
CDDcd002651.47E-40382No hitNo description
PRINTSPR004042.3E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.1E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.7E-1883168IPR002487Transcription factor, K-box
PROSITE profilePS5129711.94286173IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MVRGKTQLKR IENATSRQVT FSKRRNGLLK KALELSVLCD AEIGLIIFSA RGKLYEFASS  60
SMRDTIERYQ AHAKQCNSSS AIEHENQPSR QEAASLFTKI EHLEASKRKI LGENLESSSI  120
EELGELEIKL EQSLRKIRGK KAKEELVQLQ QKENTLAEEN TLLREKLQHK LPSAASKEVV  180
PYDISGEYAE VETELCIGCP GRGRRSGTLQ R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A1e-19372271Myocyte-specific enhancer factor 2A
3mu6_B1e-19372271Myocyte-specific enhancer factor 2A
3mu6_C1e-19372271Myocyte-specific enhancer factor 2A
3mu6_D1e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009389854.11e-146PREDICTED: MADS-box protein SOC1-like
SwissprotQ9XJ601e-68MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLM0RWS11e-151M0RWS1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P03630_0011e-150(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.19e-54AGAMOUS-like 20